Come si definisce la DCP

May 13, 2018 | Author: Anonymous | Category: Scienza, Biologia, Biochimica, Genetica
Share Embed


Short Description

Download Come si definisce la DCP...

Description

UNIVERSITA’ DEGLI STUDI DI PISA

SCUOLA DI SPECIALIZZAZIONE IN PATOLOGIA CLINICA

“Gene DNAH11: analisi di mutazione in pazienti affetti da discinesia ciliare primaria con ultrastruttura ciliare normale”

RELATORI: Dott. Paolo Simi Prof. Alessandro Casini

CANDIDATA: Dott.ssa Angela Michelucci

INDICE

INDICE

2

1. INTRODUZIONE

4

1.1 Definizione e storia della Discinesia Ciliare Primaria

4

1.2 Epidemiologia della Discinesia Ciliare Primaria

5

1.3 Funzione e caratteristiche delle ciglia della mucosa respiratoria

6

1.4 Caratteristiche cliniche della Discinesia Ciliare Primaria

7

1.5 Esami per confermare il sospetto clinico

10

1.5.1 Test di screening

10

1.5.2 Test diagnostici

11

1.6 Terapia nella della Discinesia Ciliare Primaria

20

1.7 Genetica della Discinesia Ciliare Primaria

21

1.8 Gene DNAH11

24

2. SCOPO DEL LAVORO

27

3. MATERIALE E METODI

28

3.1 Pazienti

28

3.2 Metodi diagnostici

29

3.3 Analisi genetica

29

3.3.1 Estrazione e quantizzazione del DNA

29

3.3.2 Amplificazione delle regioni codificanti del gene DNAH11 30

2

3.3.3 Analisi mediante DHPLC

31

3.3.4 Sequenziamento diretto del DNA

34

4. RISULTATI

35

4.1 Caratteristiche cliniche dei pazienti

35

4.2 Analisi dell’attività e dell’ultrastruttura delle ciglia dell’epitelio respiratorio

35

4.3 Analisi mutazionale del gene DNAH11

36

5. DISCUSSIONE

44

6. RIFERIMENTI BIBLIOGRAFICI

47

3

1. INTRODUZIONE

1.1 Definizione e storia della Discinesia Ciliare Primaria La Discinesia Ciliare Primaria (DCP) è una patologia respiratoria rara, eterogenea dal punto di vista clinico, strutturale e genetico, dovuta ad alterazioni della struttura e/o della funzione delle ciglia della mucosa respiratoria che determinano, a seguito del conseguente deficit del trasporto mucociliare, la comparsa di diversi quadri di patologia a carico delle vie aeree e del parenchima polmonare. La relazione tra movimento ciliare e fisiopatologia respiratoria è stata evidenziata per la prima volta da Afzelius in una sindrome ereditaria a trasmissione autosomica recessiva descritta nel 1933 da Kartagener e caratterizzata clinicamente dalla triade: Situs Viscerum Inversus (SVI), bronchiectasie, sinusite cronica [1-3]. Inizialmente venne studiata l’ultrastruttura degli spermatozoi, dato che una parte dei pazienti con sindrome di Kartagener era affetta anche da sterilità; successivamente vennero studiate anche le ciglia dell’apparato respiratorio, vista l’analogia ultrastrutturale tra ciglia e flagelli. Nel 1975 la sterilità maschile dovuta ad immobilità degli spermatozoi venne associata alla sintomatologia bronchitica cronica di cui soffrivano i pazienti esaminati [4]. Poiché l’alterazione prevalente, sia nelle code degli spermatozoi che nelle ciglia dell’apparato respiratorio, era la mancanza dei bracci esterni ed interni di dineina, nel 1976 Afzelius ipotizzò la presenza di un disturbo generalizzato dell’attività ciliare [5, 6], definito poi nel 1977 da Eliasson come “sindrome delle ciglia immobili” caratterizzata da sterilità, bronchite cronica dalla prima infanzia, frequentemente associato a bronchiectasie e rinosinusite cronica e nel 50% dei casi a SVI [7].

4

In seguito a queste osservazioni l’esame ultrastrutturale dell’epitelio respiratorio divenne essenziale per studiare le caratteristiche morfologiche delle alterazioni ciliari in modo da distinguere le lesioni ciliari congenite (primitive) da quelle acquisite (secondarie) dovute a processi infiammatori, acuti o cronici, a carico delle vie aeree. Inoltre la clearance muco-ciliare può essere compromessa in seguito all’esposizione ad agenti fisici o chimici [8, 9, 10] e biologici [11, 12]. E’ stato dimostrato che le ciglia non sono necessariamente immobili, ma possono presentare gradi qualitativamente e quantitativamente diversi di alterata motilità, rimanendo invariato l’effetto complessivo negativo sulle capacità di clearance ciliare della mucosa respiratoria. Il termine di “sindrome delle ciglia immobili” è stato allora sostituito con quello di DCP che include tutte le forme di anomalie congenite delle ciglia che si traducono in alterato trasporto muco-ciliare; per cui la sindrome delle ciglia immobili e la sindrome di Kartagener sono dei sottogruppi [13].

1.2 Epidemiologia della Discinesia Ciliare Primaria La DCP è una malattia rara, ma è comunque la seconda malattia congenita dell'apparato respiratorio per frequenza dopo la fibrosi cistica. L’incidenza della DCP nella popolazione è stimata intorno a 1:15000/16000 nati, sebbene sia più elevata nelle comunità dove avvengono matrimoni tra cugini di primo grado. Si può stimare che in Italia ci siano 70 nuovi nati con questa patologia ogni anno e 4000 soggetti affetti, ma molti di essi non sono stati fino ad oggi ancora individuati [14].

5

1.3 Funzione e caratteristiche delle ciglia della mucosa respiratoria La rimozione dalle vie aeree di inquinanti ambientali, agenti batterici e agenti virali inalati è un importante sistema di difesa del polmone espletato mediante i meccanismi di trasporto mucociliari. Se questi meccanismi sono insufficienti aumenterà la suscettibilità alle infezioni respiratorie con conseguente ostruzione delle vie aeree [15]. Ci sono 5 cellule ciliate per un elemento ghiandolare muco-secernente. Ogni cellula dell’epitelio respiratorio possiede 250-300 ciglia sulla propria superficie apicale e queste rivestono la mucosa delle vie aeree dalle cavità nasali fino ai bronchioli respiratori. Il diametro delle ciglia è di circa 0,3 μm, mentre loro lunghezza decresce da 6 μm in trachea a 3,6 μm a livello della 7° generazione bronchiale e si riduce ulteriormente verso la periferia del polmone. Le ciglia dell’epitelio respiratorio sono dotate di movimento, con il quale provvedono al drenaggio verso l’esterno del muco presente nelle vie aeree, impedendone il ristagno. Le ciglia si muovono per ¼ del loro ciclo spostando il muco verso la bocca e per ¾ si piegano in direzione opposta (fase attiva di ritorno). Esse battono ad una frequenza di 12 Hz (12 battiti il minuto). Il battito ciliare normale non è simultaneo, ma è coordinato in modo da generare onde metacronali, che viaggiano in direzione opposta all’effettivo battito ciliare ed al flusso di muco. In tal modo le secrezioni sono spostate contro gravità. La tosse è un meccanismo compensatorio quando la clearance tracheobronchiale è alterata. Infatti agisce come una pompa che impiega l’energia prodotta dal flusso aereo per rimuovere il muco [16].

6

1.4 Caratteristiche cliniche della Discinesia Ciliare Primaria I bambini con DCP possono essere asintomatici alla nascita, ma frequentemente già nel periodo neonatale presentano distress respiratorio o infezioni ricorrenti delle vie aeree inferiori in cui la tosse catarrale è spesso

bronchiectasie. Abitualmente si riscontrano anche infezioni delle vie aeree superiori spesso con sinusite cronica, poliposi nasale ed otite media ricorrente. In questi bambini di solito sono presenti secrezioni muco-purulente nelle cavità nasali e sono comuni ostruzione nasale, rinorrea, gocciolamento di muco dalle fosse nasali posteriori sul retrofaringe ed anosmia. La diagnosi di DCP è sicuramente più facile quando è presente anche la malrotazione dei visceri interni (con destrocardia, situs inversus addominale o totale), dovuta alla perdita della normale rotazione degli organi per la mancata influenza del movimento delle ciglia embrionali nell’abituale distribuzione asimmetrica degli organi interni [17]. Esistono un’ampia varietà di manifestazioni cliniche, che vanno da sintomi lievi a sintomi gravi. E’ comunque necessario non trascurare la possibilità di un corretto inquadramento anche in presenza dei sintomi lievi per evitare la progressione dell'impegno respiratorio. Riassumendo, le presentazioni più caratteristiche della DCP sono una o più delle seguenti [18]: - presentazione in epoca neonatale:

7

-

tachipnea inspiegabile

-

distress respiratorio

-

polmonite neonatale

-

rinorrea

-

destrocardia o situs inversus totale

-

cardiopatia congenita complessa particolarmente con disordini della lateralità

-

atresia esofagea o biliare

-

idrocefalo

- presentazione in età pediatrica: -

asma atipica o non responsiva ai trattamenti

-

tosse cronica di tipo catarrale

-

tosse produttiva nei bambini più grandi

-

reflusso gastro-esofageo molto severo

-

bronchiectasie

-

rinosinusite

-

otite media sierosa cronica di grado severo

-

alterazione della chemiotassi dei neutrofili

- presentazione nell'adulto: -

stessi sintomi dei bambini in età pediatrica

-

sub-fertilità femminile: danno della funzione ciliare a livello delle tube di Falloppio

-

infertilità maschile: numero normale di spermatozoi ma con alterata motilità

8

In generale, le caratteristiche cliniche in pazienti con DCP non differiscono da quelle riscontrate in pazienti con patologia respiratoria cronica non dovuta a difetti ciliari. Infatti, in uno studio è stata confrontata l’incidenza di alcune caratteristiche cliniche in pazienti con infezioni respiratorie ricorrenti dovute alla DCP ed in pazienti senza DCP. Alcune differivano in maniera significativa (storia di infezioni respiratorie ricorrenti nei fratelli, distress respiratorio neonatale in bambini nati a termine senza altra causa apparente, otite media cronica, rinite purulenta, malrotazione di organi), mentre altre non differivano (incidenza di collasso lobare, sinusite, bronchiectasie, dita “a bacchetta di tamburo”, tosse (figura 1) [19].

Figura 1. Incidenza delle manifestazioni cliniche in bambini affetti da infezioni respiratorie ricorrenti con DCP (barre scure) o senza DCP (barre chiare).

Il problema della diagnosi precoce della DCP è molto importante ed è emerso maggiormente sia dall’osservazione di una sua elevata incidenza (5.6%) nei bambini con infezioni respiratorie ricorrenti, sia dalla dimostrazione di un progressivo deterioramento della funzione polmonare che appare tanto maggiore quanto più tardiva

9

è la diagnosi e l’istituzione di un adeguato trattamento. Inoltre è necessaria un’accurata diagnosi differenziale tra patologia ciliare primaria e secondaria poiché la clearance muco-ciliare può anche essere compromessa dall'esposizione ad agenti fisici o chimici e biologici.

1.5 Esami per confermare il sospetto clinico Nei casi in cui sia presente un fondato sospetto e siano state escluse altre cause compatibili con il quadro clinico (fibrosi cistica, deficit immunitari) è necessario effettuare inizialmente dei semplici test di screening (valutazione del trasporto mucociliare e determinazione dell’ossido nitrico nasale) seguiti eventualmente da test diagnostici più sofisticati (analisi dell’attività ciliare, esame ultrastrutturale delle ciglia dell’epitelio respiratorio, colture cellulari).

1.5.1 Test di screening 1. Valutazione del trasporto muco-ciliare Il test alla saccarina è un test semplice che si basa sulla valutazione del tempo che intercorre tra il posizionamento di una piccola quantità di saccarina a livello del turbinato nasale inferiore e la rilevazione della stessa nel cavo orofaringeo, attraverso la percezione del suo sapore da parte del soggetto. Nei bambini può risultare difficile ottenere risposte attendibili [14]. La scintigrafia con tecnezio-99 è sicuramente un test più obiettivo poiché non richiede la collaborazione del paziente. Una goccia di sospensione di particelle colloidali marcate con tecnezio-99 viene posta circa 1 cm dietro la giunzione

10

mucocutanea della cavità nasale, sul turbinato inferiore o lungo il pavimento laterale. Viene poi registrato il movimento della radioattività.

2. Determinazione dell’ossido nitrico nasale La determinazione dell’ossido nitrico (NO) nasale può essere effettuata fin dai primi mesi di vita. Fisiologicamente l’NO viene prodotto dalla NO-sintetasi a livello del corpuscolo basale delle ciglia dell’epitelio respiratorio ed è coinvolto nella modulazione del battito ciliare. Nella DCP i livelli di NO nasale sono tipicamente ridotti (inferiori a 250 ppb) [20, 21]. E’ comunque opportuno ricordare che l’anormalità sia del test alla saccarina sia della determinazione del NO nasale non è esclusiva della DCP. Infatti possono riscontrarsi valori alterati anche in altre condizioni patologiche quali fibrosi cistica, rinosinusiti, mentre valori normali permettono comunque di escludere la DCP.

1.5.2 Test diagnostici 1. Analisi dell’attività ciliare Questo test deve essere effettuato nei bambini con problemi respiratori cronici perché è l’unico modo per distinguere le alterazioni primitive da quelle secondarie. Dal punto di vista diagnostico sono importanti sia la frequenza del battito che il tipo di movimento ciliare. La tecnica maggiormente utilizzata per il prelievo è quella del brushing nasale mediante uno spazzolino citologico [22]. Nei bambini il campionamento viene effettuato a livello dei turbinati nasali inferiori dato che le alterazioni ultrastrutturali delle ciglia nasali correlano in maniera significativa con quelle bronchiali [23]. E’ una

11

tecnica semplice, poco invasiva e non necessita di anestesia, ma richiede comunque una serie di accorgimenti in modo da ottenere un campione adeguato: la mucosa dovrebbe essere prelevata lontano da infezioni respiratorie acute o da riacutizzazioni di una patologia cronica e i pazienti non dovrebbero assumere farmaci nelle 48 ore precedenti. I campioni di ciglia prelevati vengono messi in un mezzo di coltura e analizzati al microscopio ottico dotato di contrasto interferenziale di fase con obiettivo ad immersione (x100). Il microscopio è connesso con una videocamera che consente la ripresa in tempo reale delle immagini ad elevato ingrandimento (figura 2).

Monitor

Digital Video Recorder

Digital Color Video Camera Optical Microscope

Image Processing Unit

Figura 2. Strumentazione per l’analisi dell’attività delle ciglia respiratorie in vitro.

Per valutare l’attività ciliare vengono valutati sia la frequenza del battito che il pattern motorio. La frequenza normale del battito ciliare a livello della mucosa respiratoria è di circa 12 Hz (12 battiti al secondo). La DCP invece è caratterizzata da una frequenza del battito molto bassa o assente, ma in alcuni casi possono essere presenti ciglia dotate di un movimento iperfrequente [24]. Nel normale pattern motorio le ciglia della stessa fila battono in modo sincrono

12

(figura 3), quelle della fila contigua battono nella stessa direzione (allineamento ciliare) e nella stessa fase (coordinazione ciliare), anche se con un piccolo ritardo che determina il tipico movimento a onda metacronale, paragonata ad un campo di grano mosso dal vento (figura 4).

Figura 3. Battito ciliare normale: movimento a frusta.

Figura 4. Battito ciliare normale: onda metacronale.

Nella DCP sono state riscontrate diverse anomalie del pattern motorio: “a frullino”, “a metronomo, “a cavaturaccioli”, “di prensione dell’apice”, “di sottile tremolio” (figura 5). Questi difetti del pattern motorio sono stati correlati, anche se non sempre, con specifiche alterazioni della ultrastruttura ciliare [25].

13

Figura 5. Anomalie del pattern motorio ciliare.

Il tipo di movimento o la presenza di ciglia immobili viene giudicata significativa se è osservata in almeno il 40% dei campi microscopici [26]. L’analisi dell’attività ciliare in vitro con la valutazione della frequenza del battito ciliare e del pattern di movimento è essenziale nell’iter diagnostico della DCP. Infatti, rappresenta un test diagnostico in grado di individuare i soggetti da sottoporre ad esame ultrastrutturale delle ciglia dell’epitelio respiratorio, ma è anche essenziale per giungere ad una diagnosi di certezza di DCP. Infatti, in pazienti con significative alterazioni del movimento ciliare ma senza alcuna anomalia ultrastrutturale dimostrabile, viene effettuato nuovamente il test per l’analisi dell’attività ciliare in vitro dopo un prolungato periodo di trattamento fisioterapico e farmacologico [24]. Esistono comunque casi di DCP con ultrastruttura normale per cui la diagnosi definitiva è posta in seguito alla valutazione complessiva degli elementi clinici e delle indagini di laboratorio. 2. Esame ultrastrutturale delle ciglia dell’epitelio respiratorio Una parte delle cellule poste in coltura dopo il prelievo viene utilizzata per l’esame ultrastrutturale al microscopio elettronico a trasmissione ad ingrandimenti iniziali variabili da 45000 a 91000. Il campionamento mediante brushing nasale è

14

attendibile dal punto di vista diagnostico poiché le alterazioni ultrastrutturali delle ciglia nasali correlano in maniera significativa con quelle bronchiali [23]. Al microscopio elettronico un ciglio normale in sezione trasversale appare costituito da una complessa struttura centrale, l’assonema, formata da 9 coppie di microtubuli periferici e 2 microtubuli centrali singoli [27]. I microtubuli sono lunghi tubi cavi di natura proteica formati da dimeri di tubulina. Questi dimeri di tubulina (α e β), allineati in successione, formano dei protofilamenti che si affiancano e si dispongono intorno ad una cavità centrale dando origine ai microtubuli. Nei protifilamenti i dimeri sono sfalsati in modo che la tubulina α di un dimero è in contatto con la tubulina β di quello vicino. Ogni coppia periferica di microtubuli è costituita da due subfibre, A e B. La subfibra A è un microtubulo completo formato da 13 protofilamenti, la subfibra B è un microtubulo incompleto formato da 11 protofilamenti. I microtubuli centrali sono formati da 13 protofilamenti di tubulina [27]. In vivo esistono centri di organizzazione, detti corpuscoli basali, che agiscono come stampo per disporre i microtubuli a coppie con il pattern 9+2. Il corpuscolo basale è una struttura cilindrica posta nella porzione apicale del citoplasma della cellula ciliata che contiene un anello di 9 triplette di microtubuli (A, B, C) ed ogni tripletta contiene un microtubulo completo (A) fuso con altri due incompleti (B e C). Come nell’assonema, anche nel corpuscolo basale esistono legami proteici di stabilizzazione, in particolare tra la subfibra A di una tripletta e la subfibra C di quella vicina. L’assetto 9+2 dei microtubuli dell’assonema si modifica anche nella porzione apicale del ciglio: le coppie periferiche perdono progressivamente la subunità B del microtubulo, la coppia centrale ed i bracci di dineina [27].

15

I microtubuli che compongono l’assonema sono stabilizzati nell’assetto 9+2 da diverse proteine. La proteina più importante è la dineina, le cui molecole sono organizzate a formare coppie di bracci, interno ed esterno, in grado di influenzare rispettivamente il pattern e la frequenza del battito ciliare [27]. Il braccio esterno è formato da: 2 catene pesanti con attività ATPasica che formano le teste globulari del complesso, 2 o più catene intermedie, 4-8 catene leggere che determinano l’ancoraggio del complesso dineinico alla superficie del microtubulo della subfibra A. Il braccio interno ha una struttura simile al braccio esterno, ma sembra esistere in tre distinti tipi che contengono isomeri diversi di dineina [27]. Altre proteine sono implicate nella regolazione del tipo di battito: la nexina, che costituisce una fascia intorno all’intero assonema, i ponti radiali, che connettono ogni coppia di microtubuli periferici a quella centrale, la guaina interna, che avvolge ad anello i microtubuli centrali (figura 6) [28]. E’ stato dimostrato che i responsabili del movimento ciliare sono i bracci di dineina. Infatti l’assonema isolato è in grado di compiere movimenti di flessione se immerso in una soluzione salina contenente ATP e ioni magnesio, per cui il corpuscolo basale e la membrana plasmatici non sono necessari. Inoltre, esponendo assonemi isolati all’azione di enzimi proteolitici che distruggono nexina e ponti radiali, ma lasciano intatti microtubuli e dineina, l’assonema è in grado di allungarsi fino a 9 volte rispetto alla sua lunghezza iniziale in presenza di ATP. Al contrario, negli assonemi isolati e senza bracci di dineina il movimento non è più presente. Questo ricompare con l’aggiunta di dineina e ATP [27]. La dineina è un’ATPasi e con l’idrolisi di ATP ogni braccio di dineina genera una forza che agisce in modo da spostare verso l’apice del ciglio la coppia di

16

microtubuli adiacenti con cui prende contatto. Se tutti i bracci si attivassero nello stesso momento, l’assonema si avvolgerebbe a formare un’elica stretta, per questo è proprio la loro attivazione asincrona a permettere il tipico movimento a frusta del ciglio. Grazie alla presenza di nexina e di ponti radiali, che offrono punti fermi di ancoraggio, il movimento di scorrimento si trasforma in movimento di flessione.

Figura 6. Schema di un ciglio in sezione trasversale.

La struttura dell’assonema è estremamente complessa per cui sono possibili molti tipi di lesioni. Questa eterogeneità strutturale implica, in ogni caso, la perdita del ruolo fisiologico protettivo e lo stesso difetto funzionale, cioè l’incapacità del ciglio di rimuovere il muco e di conseguenza il suo ristagno, che comporta l’insorgere di quadri patologici a carico delle alte e basse vie respiratorie [29]. Le anomalie ultrastrutturali caratteristiche di patologia ciliare congenita, riviste da Afzelius nel 1987 [30] e confermate in seguito da altri autori [26, 29, 31, 32] sono rappresentate da:

17

1. Assenza, riduzione o accorciamento dei bracci interno e/o esterno di dineina. 2. Assenza dei ponti radiali e/o assenza della guaina centrale, con conseguente decentramento dei microtubuli centrali. 3. Assenza o accorciamento dei microtubuli centrali e spostamento della coppia n. 1 di microtubuli periferici al centro (trasposizione). 4. Assenza dei legami di nexina, dei ponti radiali, dei bracci interni di dineina, con conseguente perdita della disposizione circolare delle coppie di microtubuli e “disorganizzazione” dell’assonema. 5. Assenza dei microtubuli centrali e dei bracci interni di dineina. 6. Abnorme lunghezza delle ciglia. 7. Assenza delle ciglia e dei relativi corpuscoli basali. 8. Alterazione del normale orientamento delle ciglia. E’ stata descritta una certa correlazione tra specifiche alterazioni ultrastrutturali e tipo di anomalia del movimento (tabella 1) [33]. Ultrastruttura ciliare

Difetto di motilità Movimento a frullino

Assenza dei bracci di dineina

Movimento a metronomo Rigido movimento su un piano Rigido movimento vibratorio

Difetto dei ponti radiali

Difetto di traslocazione Ultrastruttura normale

Movimento di rotazione a cavaturaccioli Rigido movimento su un piano Movimento di prensione dell’apice con base rigida Movimento rotazionale Movimento di sottile tremolio

Tabella 1. Correlazione tra ultrastruttura ciliare e difetto di motilità

18

Correlato allo stato di flogosi esiste un pattern di lesioni sostanzialmente diverso da quello rilevato nelle forme congenite. Sono alterazioni secondarie, aspecifiche, presenti fino ad un 10% anche nelle ciglia di soggetti normali ed in percentuale maggiore nei vari tipi di patologia acquisita, sia acuta che cronica, dell’apparato respiratorio (discinesie ciliari secondarie; DCS). Il pattern di queste lesioni è rappresentato da: 1. ciglia con aumento della matrice citoplasmatica (swollen cilia) 2. ciglia con più di un assonema all’interno di una singola membrana (assonemi multipli) 3. ciglia che si proiettano in larghe cavità intracellulari (ciglia intracitoplasmatiche) 4. alterazioni a carico delle coppie periferiche o dei microtubuli periferici (assenti o aggiuntivi) 5. dislocazione di una o più coppie periferiche 6. microtubuli incompleti 7. alterazioni della coppia o dei microtubuli centrali (assenti o aggiuntivi). Inoltre, esiste un gruppo di soggetti definito “borderline” che presenta un pattern intermedio. Presentano cioè una percentuale di elementi patologici superiore a quella riscontrata nelle forme acquisite di flogosi cronica ed un pattern ultrastrutturale caratterizzato dalla presenza di alterazioni “specifiche” dei bracci di dineina e/o della coppia centrale, associato ad un numero variabile di lesioni secondarie. Tale gruppo, eterogeneo dal punto di vista clinico, comprende sia soggetti con una maggiore predisposizione ad ammalarsi ed una minore tendenza alla risoluzione del quadro clinico, sia soggetti con deficit congenito parziale.

19

L’esame ultrastrutturale delle ciglia ha un ruolo essenziale nell’iter diagnostico delle affezioni respiratorie croniche in quanto permette di distinguere le forme congenite da quelle acquisite sia da un punto di vista qualitativo che quantitativo. Infatti, difetti comunemente considerati di natura congenita possono essere anche conseguenza di una flogosi cronica [34]. Esistono comunque delle forme congenite con ultrastruttura normale che rendono più difficoltosa la diagnosi differenziale [35, 36]. Inoltre esiste la possibilità che alterazioni ultrastrutturali considerate tipiche di DCP siano reversibili con il miglioramento clinico. Per questi motivi lo studio ultrastrutturale non può essere considerato un criterio assoluto per la diagnosi di DCP [28]. 3. Colture cellulari delle ciglia dell’epitelio respiratorio Nei casi in cui la diagnosi di DCP risulti particolarmente complessa, a causa di un esame ultrastrutturale non informativo e di un esame dell'attività ciliare influenzato da un’importante flogosi persistente a livello delle cavità nasali, possono essere impiegate le colture di cellule epiteliali ciliate in ambiente privo di agenti nocivi. In presenza di rigenerazione ciliare è infatti possibile escludere la natura congenita delle alterazioni precedentemente evidenziate.

1.6 Terapia nella della Discinesia Ciliare Primaria Ad oggi non esistono trattamenti specifici in grado di correggere la disfunzione ciliare che è alla base delle manifestazioni presenti nella DCP. E’ importante intervenire con l’applicazione di misure fisioterapiche in modo da rimuovere le secrezioni che, accumulandosi nelle vie aeree, favoriscono il ripetersi di processi infettivi responsabili sia del danno strutturale che del decadimento della funzione respiratoria e quindi della progressione della malattia. Le vaccinazioni regolari e i trattamenti antibiotici precoci,

20

associati alla fisioterapia respiratoria, in caso di infezioni polmonari, aiutano a limitare lo sviluppo della bronchiectasia. Nei pazienti affetti da insufficienza respiratoria allo stadio finale, deve essere proposto il trapianto polmonare. Inoltre la chirurgia si rende a volte necessaria per la correzione delle cardiopatie [37].

1.7 Genetica della Discinesia Ciliare Primaria Il Progetto Genoma Umano e gli studi sull’alga unicellulare Chlamydomonas hanno incoraggiato la ricerca e l’identificazione dei geni potenzialmente responsabili della DCP. L’analisi genetica e la consulenza genetica sono importanti per confermare il sospetto diagnostico ma anche per stabilire l’eventuale stato di portatore e informare quindi sui rischi riproduttivi per effettuare eventualmente la diagnosi prenatale. Le analisi di linkage genetico e lo studio delle mutazioni nei soggetti affetti dalla malattia hanno tuttavia dimostrato che tale condizione è estremamente eterogenea dal punto di vista genetico, anche all’interno di specifici fenotipi ultrastrutturali [38]. La DCP è generalmente trasmessa geneticamente con modalità di tipo autosomico recessivo. La malattia è dovuta a mutazioni (tabella 2) dei geni DNAH5 [39, 40, 41], DNAI1 [42, 43, 44] e più raramente nei geni TXNDC3 [45], DNAH11 [46, 47], DNAI2 [48]. Recentemente sono stati associati alla DCP altri geni: KTU/PF13 [49], LRRC50 [50], RSPH9, RSPH9, RSPH4A [51]. Inoltre una forma rara di DCP associata alla retinite pigmentosa è dovuta a mutazioni nel gene RPGR [52]. Mutazioni dei due geni DNAH5 e DNAI1, che codificano per i bracci esterni di dineina, sono responsabili di circa 18-30% dei casi di DCP, in particolare il 28% dei pazienti ha mutazioni nel gene DNAH5 e 2-10% nel gene DNAI1 mentre mutazioni negli altri geni sono rare.

21

Gene

Locus

Difetto ultrastrutturale

Fenotipo

DNAH5

5p15

ODA

DCP+SK

DNAI1

9p21-p13 ODA

DCP+SK

DNAH11

7p15.3-21 Normale

DCP+SK

TXNDC3

7p14.1

ODA

SK

DNAI2

17q25.1

ODA

DCP+SK

KTU

14q21.3

ODA+IDA

DCP+SK

RPGR

Xp21.1

Variabile

DCP con retinite pigmentosa

OFD1

Xp22

Non noto

DCP con ritardo mentale

RSPH9

6p21

CA

DCP

RSPH4A

6q22

CA

DCP

Tabella 2. Geni che sono stati descritti essere coinvolti nella DCP, locus, difetto strutturale a cui sono associati, fenotipo dei pazienti (CA, central apparatus; IDA, inner dynein arm; ODA, outer dynein arm)

I geni DNAH5 (dynein axonemal heavy chain 5), DNAI1 (dynein axonemal intermediate chain 1), TXNDC3 (thioredoxin domain containing 3), DNAI2 (dynein axonemal intermediate chain 2) codificano tutti per i bracci esterni di dineina. Sono state descritte mutazioni in questi geni in pazienti con DCP e difetti dei bracci esterni di dineina. Nel dettaglio, sono state riportate mutazioni in 32/65 famiglie (49%) per il gene

22

DNAH5 [39, 40, 41], in 25/330 pazienti (7.5%) per il gene DNAI1 [42, 43, 44], in 1/47 pazienti per il gene TXNDC3 [45] e in 3 famiglie per il gene DNAI2 [48]. Oltre ai geni che sono stati descritti essere coinvolti nella DCP, sono stati riportati molti altri geni candidati (tabella 3). L'approccio per identificare questi possibili geni candidati ha utilizzato informazioni di geni noti per causare specifici difetti ultrastrutturali in altre specie quali Chlamydomonas; per omologia con tali geni noti sono stati identificati i corrispondenti geni umani Sono stati testati questi geni candidati in vari pazienti, ma nessuna mutazione è stata identificata ad oggi [38]. Gene

Locus

Gene mutante

Difetto assonema

Difetto

N°DCP analizzati

Chlamydomonas Chlamydomonas ultrastrutturale

DNAH9 17p12

oda4

Perdita ODA

ODA HC

2

DNAH17 17q25

oda4

Perdita ODA

ODA HC

4

DNAL1 14q24.35 Non noto

Non noto

ODA LC

86

DNAL4 22q13.1

oda13

Perdita ODA

ODA LC

54

TCTE3

6q27

oda12

Perdita ODA

ODA LC

36

LC8

17q23

fla14

Perdita ODA

ODA LC

58

DNAH3 16p12

Non noto

Non noto

IDA HC

7

DNAH7 2q33.1

Non noto

Non noto

IDA HC

1

ida4

Perdita IDA

IDA LC

61

HP28

1p35.1

Tabella 3. Geni candidati per la DCP, locus, gene mutante e difetto assonema associato in Chlamydomonas, difetto strutturale e numero di pazienti analizzati (IDA, inner dynein arm; ODA, outer dynein arm; HC, heavy chain; LC, light chain)

23

1.8 Gene DNAH11 Il gene DNAH11 (dynein axonemal heavy chain 11) codifica per la catena pesante del braccio esterno di dineina, è composto da 83 esoni codificanti e copre una regione genomica di oltre 353 kb sul cromosoma 7p15.3-21. La prima mutazione nel gene DNAH11 è stata identificata mediante sequenziamento diretto. Tale mutazione omozigote nonsenso R2852X nell'esone 52 è stata evidenziata in un paziente con disomia uniparentale paterna (UPD7) e diagnosi genetica di fibrosi cistica (mutazione deltaF508 in omozigosi nel gene CFTR). Il paziente presentava anche caratteristiche cliniche della DCP, quali situs inversus totalis ed una grave compromissione respiratoria, ma la microscopia elettronica dimostrava un'ultrastruttura ciliare normale [46].

Figura 7. (A) Albero genealogico del paziente con UPD7 e rappresentazione schematica di parte del cromosoma 7 con mutazioni nei geni CFTR eDNAH11 (alleli mutanti in rosso, alleli normali in bianco). (B) Cromatogramma della sequenza di DNA dell’esone 52 di DNAH11 con mutazione nonsenso R2852X. (C) Situs inversus e ultrastruttura ciliare normale

Le catene pesanti della dineina presentano diversi domini strutturali. La coda N-terminale interagisce con gli altri domini della dineina e con il dominio che

24

costituisce il motore. Il dominio motore contiene 6 domini ATPasi della famiglia AAA (ATPases associated with cellular activities) nella testa che formano un anello. In ogni dominio AAA è presente un sito ATPasico, ma solo quello in AAA1 idrolizza ATP. Tra i domini AAA4 e AAA5 protrude un gambo che termina con il sito di legame al microtubulo (figura 8) [53].

Figura 8. (A) Rappresentazione schematica del dominio globulare di DNAH11 (B) Rappresentazione schematica della proteina DNAH11

La proteina mutata dovuta alla mutazione omozigote nonsenso R2852X è predetta contenere un normale dominio N-terminale e tre dei 6 domini AAA (figura 9). Se la proteina mutata è stabile dovrebbe essere incorporata correttamente nel complesso del braccio della dineina, ma essendo assente il sito di legame al microtubulo non si legherà a questo. L’ipotesi è compatibile con la microscopia elettronica che evidenzia un assonema e bracci di dineina normali.

Figura 9. Rappresentazione schematica dei domini di DNAH11 e posizione della mutazione R2852X.

25

Il possibile coinvolgimento del gene DNAH11 rimaneva comunque dubbio, per la concomitante presenza della fibrosi cistica in questo paziente con DCP atipica. Tuttavia, uno studio successivo condotto su un'ampia famiglia tedesca con diversi individui affetti da DCP (figura 10) ha dimostrato che anche in questo caso era coinvolto il gene DNAH11 e l'ultrastruttura delle ciglia era normale, mentre il movimento ciliare era ipercinetico [47]. In questi pazienti sono state evidenziate due mutazioni in eterozigosi composta ed è stato dimostrato che l’mRNA di entrambi gli alleli mutati è trascritto e quindi espresso. Se viene anche tradotto, l’effetto predetto delle mutazioni sarebbe: la mutazione p.Y4128X dovrebbe troncare l’intero dominio Cterminale della proteina DNAH11, la mutazione p.A4518_A4523delinsQ dovrebbe far mancare parte del dominio C-terminale e quindi il contatto tra questo e il dominio AAA1.

Figura 10. Albero genealogico della famiglia con DCP e immagini relative al situs inversus, bronchiectasie, ultrastruttura ciliare normale

Figura 11. (A) Rappresentazione schematica dei domini(B) e del dominio globulare di DNAH11 e posizione delle mutazioni p.Y4128X e p.A4518_A4523delinsQ.

26

2. SCOPO DEL LAVORO

L’identificazione di mutazioni correlabili alla DCP permetterebbe di risolvere gli attuali limiti diagnostici per il corretto e precoce inquadramento della malattia. Per questa ragione lo scopo di questo studio è stato quello di stabilire se l’analisi del gene DNAH11, per il quale sono state riportate alcune mutazioni nonsenso associate ad un’ultrastruttura dell’assonema normale, potrebbe essere utile per identificare nuove mutazioni in pazienti con DCP e ultrastruttura normale e quindi essere utilizzata anche in diagnostica per questi casi particolari.

27

3. MATERIALE E METODI

3.1 Pazienti E’ stata condotta l’analisi mutazionale del gene DNAH11 in 16 pazienti: - 10 casi (6 famiglie) con diagnosi clinica di DCP e ultrastruttura ciliare normale -

6 casi (5 famiglie) con diagnosi clinica di DCP e ultrastruttura alterata.

Nella tabella 4 sono riportati sesso, età, ultrastruttura ciliare e situs dei pazienti. N°



paziente

famiglia

Sesso

Età

Ultrastruttura

Situs

1

A

M

10

Normale

SI

2

A

F

16

Normale

SI

3

B

M

15

Normale

SS

4

B

M

15

Normale

SI

5

C

F

21

Normale

SS

6

D

F

33

Normale

SI

7

E

M

8

Normale

SI

8

F

M

3

Normale

SS

9

G

F

1

Normale

SS

10

H

F

21

Normale

SS

11

I

M

1

Alterata

SS

12

I

F

10

Alterata

SI

13

L

M

9

Alterata

SS

14

M

M

15

Alterata

SS

15

N

F

17

Alterata

SI

16

O

M

1

Alterata

SI

Tabella 4. Caratteristiche dei pazienti (SI, situs inversus; SS, situs solitus)

28

3.2 Metodi diagnostici Le ciglia dell’epitelio respiratorio sono state valutate in base alla loro morfologia, alla frequenza del battito, al pattern motorio e alla loro ultrastruttura, secondo le metodiche standard [24, 54, 55, 56, 57]. Sono state inoltre allestite le colture di cellule epiteliali ciliate in un ambiente privo di agenti nocivi per valutare la rigenerazione ciliare [58]. La determinazione dell’ossido nitrico nasale è stata condotta in accordo con le metodiche suggerite [59]. Per tutti i pazienti sono stati esclusi sia eventuali deficit immunitari, mediante il dosaggio delle immunoglobuline, sia l’eventuale presenza di fibrosi cistica, mediante il test del sudore e l’analisi molecolare del gene CFTR (Cystic Fibrosis Genotyping Assay - CFv3-CE, Abbott). Inoltre è stata valutata la funzione polmonare ed è stata eseguita la tomografia computerizzata per il torace e per i seni nasali [60].

3.3 Analisi genetica

3.3.1 Estrazione e quantizzazione del DNA Per l’analisi del gene DNAH11 è stato utilizzato un prelievo di sangue venoso in EDTA (circa 5mL) dei pazienti, dopo aver ottenuto il consenso informato. Il DNA genomico è stato estratto utilizzando il BioRobot EZ1 (Qiagen) mediante EZ1 DNA Blood Kit (Qiagen). La tecnologia, basata sulle particelle magnetiche, fornisce un DNA di alta qualità, adatto per essere utilizzato direttamente nelle applicazioni a valle quali amplificazione. Il DNA viene isolato in un’unica fase grazie al proprio legame con la superficie di silice

29

delle particelle. Le particelle vengono separate dai lisati con un magnete. Il DNA viene poi lavato ed eluito in un apposito tampone. Per conoscere la concentrazione del DNA estratto e verificare l’assenza di contaminanti quali proteine, il DNA è stato analizzato mediante il NanoDrop® ND1000 (Celbio). Questo strumento è uno spettrofotometro UV-Visibile a spettro totale (220-750nm) in grado di effettuare analisi di volumi estremamente ridotti di campione (1μl) con accuratezza e riproducibilità elevate, consentendo un notevole risparmio di materiale. Il sistema brevettato di ritenzione del campione, che sfrutta unicamente la tensione superficiale dei liquidi, permette di eliminare l’uso di cuvette e capillari, riducendo così il tempo necessario per la misura. Inoltre, il cammino ottico molto ridotto (1 mm) permette di misurare concentrazioni 50 volte più elevate rispetto ad uno spettrofotometro tradizionale, eliminando in questo modo la necessità di diluire i campioni. All’estremità di un cavo a fibre ottiche viene caricato 1 μl di DNA estratto; un secondo cavo viene posto in contatto con la soluzione in modo che il liquido funga da ponte tra le due estremità. La sorgente luminosa è costituita da una lampada allo xenon.

3.3.2 Amplificazione delle regioni codificanti del gene DNAH11 Gli

83

esoni

codificanti

del

gene

DNAH11

(Ensembl

Gene

ID:

ENSG00000105877) e le regioni fiancheggianti sono stati amplificati tramite la reazione di Polymerase Chain Reaction (PCR). La PCR è una reazione di amplificazione in vitro del DNA che sfrutta gli elementi di base del naturale processo di replicazione.

30

Le reazioni di amplificazione sono state effettuate in un volume finale di 50µl, partendo da circa 80 ng di DNA genomico, e utilizzando Buffer, Mg++, Taq polimerasi “Optimase” (Transgenomic), 200mM di dNTPs e una coppia di primers specifica per ciascun amplificato. I primers sono stati disegnati utilizzando il programma disponibile on-line

Primer3

(http://frodo.wi.mit.edu/cgi-bin/primer3/primer3_www.cgi).

L’amplificazione è stata effettuata utilizzando un termociclatore BioRad v.4.01 mediante una touch-down PCR con i seguenti cicli di amplificazione: T denaturazione iniziale = 95°C per 5 min T denaturazione = 95°C per 30 sec T annealing = 61°C per 30 sec

Decremento di 0.5°C per 10 cicli

T estensione = 72°C per 30 sec T denaturazione = 95°C per 30 sec Per 30 cicli

T annealing = 56°C per 30 sec T estensione = 68°C per 30 sec

Successivamente, 10 μl del prodotto di PCR sono stati sottoposti ad elettroforesi su gel al 2% di agarosio e visualizzato, tramite lampada UV, con colorazione di etidio bromuro. I campioni ben amplificati mostravano un’unica banda ad un’altezza corrispondente alla lunghezza del frammento di interesse.

3.3.3 Analisi mediante DHPLCLa cromatografia liquida ad alta pressione in condizioni denaturanti (DHPLC - Denaturing High Pressure Liquid Chromatography) impiega un meccanismo di ripartizione in fase inversa ad accoppiamento ionico. Esso, infatti, separa le molecole di DNA sulla base della loro dimensione crescente.

31

La colonna cromatografica contiene una fase stazionaria (o matrice), formata da particelle di polistirene-divinilbenzene (diametro medio 2.3 μm), che viene sottoposta alla reazione di alchilazione, necessaria per un’analisi ad alta risoluzione degli acidi nucleici. La fase mobile è costituita da una miscela di due soluzioni A e B. La soluzione A consiste in un reagente carico positivamente, il trietilammonioacetato (TEAA) 100mM pH 7.0, mentre la soluzione B contiene TEAA 100mM e 25% di acetonitrile (ACN) pH 7.0. Il TEAA, costituito da una porzione idrofobica ed una idrofilica, permette alle molecole di DNA, cariche negativamente, di interagire con la matrice idrofobica della colonna facendo da ponte: la porzione idrofilica (carica positivamente) interagisce con i gruppi fosfato (carichi negativamente) delle molecole di DNA, mentre quella idrofobica interagisce con la fase stazionaria della colonna. Il DNA eteroduplex si genera quando un frammento amplificato di DNA mutato ed uno non mutato vengono denaturati termicamente e poi fatti riappaiare. Nel punto della mutazione le due singole eliche non sono in grado di formare legami a idrogeno perché le basi risultano non correttamente appaiate per cui si formeranno delle porzioni di DNA a singola elica (bolle). La proprietà fondamentale di tali bolle nel DNA a doppia elica (dsDNA), è quella di avere una minore densità di gruppi fosfato e, quindi, una minore densità di carica rispetto al doppio filamento, garantendo così una minore ritenzione della molecola sulla fase stazionaria e un tempo di eluizione inferiore a quello dell'omoduplex. Prima dell’analisi al DHPLC i prodotti amplificati e miscelati con un campione wild type vengono denaturati a 95°C per 5 min, e poi vengono fatti riappaiare mediante un graduale decremento di temperatura. Una volta posizionati nella piastra del DHPLC la siringa preleva 8μl del campione e li immette nel flusso di tampone di corsa pompato

32

verso la colonna. Per gli ampliconi del gene DNAH11 è stato utilizzato un flusso di 0.9 μl/min con un tempo di eluizione del frammento di 7 minuti. Per ciascun amplicone sono determinate specifiche condizioni di corsa, di temperatura e di gradiente dei buffers A e B, mediante l’utilizzo del software Navigator v.2.2.0 (Transgenomic) sulla base della sequenza del DNA da analizzare. Il campione, attraversando la colonna, è separato alla sua temperatura di quasi denaturazione; il rivelatore agli UV registra il passaggio delle molecole di DNA, riportando i risultati delle migrazioni in un cromatogramma. Nel caso di un DNA senza mutazione il cromatogramma riporta un solo picco, mentre la presenza di ulteriori picchi segnala la presenza di una mutazione (nella separazione ideale si osservano quattro picchi, due che corrispondono agli eteroduplex e due agli omoduplex). I primi picchi, in ordine di tempo di eluizione, corrispondono agli eteroduplex, i successivi contengono gli omoduplex (figura 12).

Figura 12. Formazione di eteroduplex e omoduplex e relativo cromatogramma.

33

3.3.4 Sequenziamento diretto del DNA Il DNA amplificato il cui profilo di eluizione corrispondeva ad un eteroduplex è stato sottoposto ad analisi di sequenza per rilevare eventuali mutazioni. La metodica del sequenziamento a cicli (Cycle Sequencing) utilizza processi automatizzati che sfruttano la fluorescenza. In particolare, nel sequenziamento vengono marcate con fluorofori diversi ciascuna delle quattro basi modificate, dideossinucleotidi base specifici (ddNTP), chiamati anche terminatori di catena. Questi ultimi sono analoghi ai dNTP normali, ma differiscono perché mancano di un gruppo idrossile al 3’. Tale ddNTP può essere incorporato nella catena di DNA in via di sintesi, tramite la formazione di un legame fosfodiesterico tra il suo carbonio (C) in posizione 5’ e il C in posizione 3’ del nucleotide incorporato precedentemente. Al ddNTP non si può attaccare tuttavia nessun altro dNTP perché, mancando il gruppo OH in posizione 3’, non può creare il ponte fosfodiesterico con il C in posizione 5’ del dNTP successivo. La reazione si arresta e si formeranno frammenti di lunghezza diversa. Il prodotto della reazione di sequenza è poi caricato sull’analizzatore automatico Genetic Analyzer ABI PRISM 3130xl (Applied Biosystems): una volta che il frammento di DNA passa attraverso una camera di rilevazione viene registrato il segnale fluorescente emesso in seguito ad eccitazione laser. Il software associa ad ogni fluoroforo un picco di colore diverso per cui il risultato è una serie di picchi di intensità per ognuno dei diversi fluorocromi colorati che formeranno un elettroferogramma corrispondente alla sequenza in esame. La reazione di sequenza a cicli è eseguita utilizzando ABI Prism BigDye Terminator Cycle Sequencing ready Reaction Kit v3.1 (Applied Biosystems) con il termociclatore BioRad v.4.01.

34

4. RISULTATI

4.1 Caratteristiche cliniche dei pazienti Tutti i pazienti avevano una diagnosi clinica di DCP, la cui sintomatologia è esordita fin dalla prima epoca della vita ed ha avuto un decorso ricorrente – recidivante. I pazienti presentavano infezioni delle vie aeree superiori ed inferiori, pansinusite. Inoltre avevano sviluppato esiti respiratori a livello toracico quali bronchiectasie che erano state dimostrate radiologicamente mediante TC del torace ad alta risoluzione.

4.2 Analisi dell’attività e dell’ultrastruttura delle ciglia dell’epitelio respiratorio Lo studio dell’analisi ciliare ha dimostrato la presenza di movimenti ipercinetici e caratterizzati da un pattern motorio rigido e costante associato ad ultrastruttura ciliare normale (figura 13), nei soggetti con due mutazioni nel gene DNAH11 (tabella 5). Gli altri pazienti presentavano delle alterazioni ultrastrutturali a carico della dineina (assenza o accorciamento dei bracci interni ed esterni) (figura 14), erano prevalentemente caratterizzati da ciglia immobili e solo in due casi presentavano movimenti rigidi.

Figura 13. Ultrastruttura ciliare normale

35

Figura 14. Assenza dei bracci interni ed esterni di dineina N°

Freq. ciglia

Freq. ciglia

Freq. ciglia

% ciglia

paziente

min (Hz)

max (Hz)

media(Hz)

rigide

1

1

16

11.5

58.8

2

0.5

15

7.4

45.4

3

1.5

22

12.2

52.2

4

0.5

11

7.4

11.8

5

2.00

22

11.1

63.00

6

1

22

5.6

87.5

7

0.5

15

7

16.7

8

3

9

5.8

18.7

Tabella 5. Frequenza minima, massima, media delle ciglia e percentuale di ciglia rigide

4.3 Analisi mutazionale del gene DNAH11 Nei 10 pazienti con DCP e ultrastruttura ciliare normale, sono state evidenziate mutazioni nel gene DNAH11 in 8 casi (tabella 6), mentre in 2 casi non sono state rilevate mutazioni. Tutti i pazienti mutati presentano due mutazioni (biallelica): 7 in eterozigosi composta e 1 in omozigosi. L’analisi per lo stato di carrier dei genitori ha evidenziato per tutti i pazienti che entrambi i genitori sono portatori di una mutazione per cui le mutazioni nei pazienti

36

sono in trans, in accordo con la trasmissione di tipo autosomico recessiva. I genitori sono tutti non consanguinei tranne per la mutazione p.T4052P in omozigosi del paziente 8 i cui genitori sono cugini di primo grado. La mutazione p.R2250X è presente nei due fratelli della famiglia B, ma anche nel paziente 6 non appartenente alla stessa famiglia. Questo è il primo caso di mutazione ricorrente nel gene DNAH11 in pazienti non appartenenti alla stessa famiglia. N° paziente 1

2

3

4

5

6

7

8

Esone

Cambiamento

Cambiamento

Tipo di

nucleotidico

proteico

mutazione

5

c.883-1G>A

/

Splicing alterato

23

c.4145G>A

p.W1382X

Nonsenso

5

c.883-1G>A

/

Splicing alterato

23

c.4145G>A

p.W1382X

Nonsenso

42

c.6748C>T

p.R2250X

Nonsenso

67

c.10810C>T

p.Q3604X

Nonsenso

42

c.6748C>T

p.R2250X

Nonsenso

67

c.10810C>T

p.Q3604X

Nonsenso

11

c.1949C>G

p.S650X

Nonsenso

35

c.5865C>G

p.N1955K

Missenso

4

c.852_854delGAG

/

Delezione

42

c.6748C>T

p.R2250X

Nonsenso

50

c.8135A>G

p.H2712R

Missenso

64

c.10284G>A

p.G3429R

Missenso

p.T4052P

Missenso

75

c.12154A>C omozigosi

Tabella 6. Mutazioni nel gene DNAH11: esone, cambiamento nucleotidico e proteico, tipo di mutazione

37

Nessuna delle mutazioni identificate nel gene DNAH11 è stata precedentemente descritta (Human Gene Mutation Database, http://www.hgmd.cf.ac.uk/ac/index.php). Sono state quindi identificate 10 diverse mutazioni nel gene DNAH11 di vario tipo: mutazioni nonsenso (n=4), mutazioni di splicing (n=1), mutazioni missenso (n=4), piccole delezioni (n=1). Tutte le mutazioni sono state ricercate in 200 cromosomi di controllo, per escluderle come polimorfismi, e non sono state evidenziate in questa popolazione di controllo. Per predire il possibile effetto deleterio delle varianti missenso è stata condotta un’analisi in silico con il programma PolyPhen (http://genetics.bwh.harvard.edu/pph/); inoltre è stato valutato se tali sostituzioni aminoacidiche siano presenti in residui aminoacidici evolutivamente conservati tra proteine appartenenti a differenti specie. Di seguito sono mostrati i risultati ottenuti.

Posizione AA1 AA2 1955

N

K

Risultato This mutation is predicted to be probably damaging with a score of 0.975 (sensitivity: 0.75; specificity: 0.96)

H. sapiens 1945 TGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLGEAITLKP C. lupus 1941 TGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLGEAITLKP B. taurus 2074 TGAWGCFDEFNRISVEVLSVVSVQVKMIHDAIRNRKERFVFLGEAIILKP M. musculus 1919 TGAWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRNGRKRFVFLGETIPLKP R. norvegicus 1997 TGAWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRSRRRRFVFLGETIPLKP D. rerio 1908 TGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKQRFHFLGEDIELRS

38

1994 1990 2123 1968 2046 1957

Posizione AA1 AA2 2712

H

R

Risultato This mutation is predicted to be probably damaging with a score of 1.000 (sensitivity: 0.00; specificity: 1.00)

H. sapiens 2683 LRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFASP C. lupus 2670 LKSGPSLIQATITFHQMMTHNFLPTAVKFHYLFNLRDLSNIFQGILFASP B. taurus 2812 LRSGPTLIQATIAFHQMMAHTFLPTAIKFHYLFNLRDLSNVFQGILFTSP M. musculus 2648 LRAGPSLIQATIAFHQMMAESFVPTAIKFHYNFNLRDLSNIFQGILFASP R. norvegicus 2732 LRTGPSLIQATIAFHQTMAENFVPTAIKFHYNFNLRDLSNIFQGILFASP D. rerio 2637 SRMSSTLVQAAICLHQKMSQNFLPTAIRFHYIFNLRDISSIFQGILFALP

Posizione AA1 AA2 3429

G

R

2732 2719 2861 2697 2781 2686

Risultato This mutation is predicted to be probably damaging with a score of 0.999 (sensitivity: 0.14; specificity: 0.99)

H. sapiens 3383 IKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSYVGPFT C. lupus 3370 IELANRLVKELESEKIRWCQSIQSFEAQEQTLCGDVLLTAAFVSYVGSFT B. taurus 3512 IELANRLVRELEVKKIRWGQSIKSFEAQEKTLCGDVLLTAAYVSYVGSFT M. musculus 3348 IDLANKLVSELESEKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIGSFT R. norvegicus 3432 IDLANRLVSELESEKIRWGQSIKSFETQEKTLCGDVLLTAAFVSYIGSFT D. rerio 3337 ILLANRLVKGLESENIRWAHSVAQYREQESTLCGDVLLTAAFISYAGSFS

39

3432 3419 3561 3397 3481 3386

Posizione AA1 AA2 4052

T

P

Risultato This mutation is predicted to be probably damaging with a score of 0.988 (sensitivity: 0.65; specificity: 0.95)

H. sapiens 4032 APTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKE C. lupus 4019 APTPNEHIIPQGLLEDSIKITNEPPTGMMANLHAALYNFDQDTLEACSKE B. taurus 4161 ASIPSEHVIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEVCSKE M. musculus 3997 VPSQHEPIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEMCSKD R. norvegicus 4081 APSQHEPVIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEMCSKD D. rerio 3987 SPTPQEHIIPQGILENSIKITNEPPTGMLANLHAALDNFDQDILDQCSRE

4081 4068 4210 4046 4130 4036

Le quattro mutazioni missenso identificate colpiscono tutte residui molto conservati tra le specie e l’analisi in silico prevede che siano tutte potenzialmente dannose, con un’alta probabilità di avere un effetto deleterio sulla conformazione e sulla funzione della proteina (score>0.97). In entrambi i fratelli della famiglia A è stata evidenziata, oltre alla mutazione p.W1382X, la mutazione c.883-1G>A nel sito di splicing accettore dell’introne 4 (figura 15). E’ stata condotta l’analisi in silico con il programma Splice Site Prediction by Neural Network (http://www.fruitfly.org/seq_tools/splice.html) per predire il possibile effetto di questa mutazione. L’analisi ha mostrato che la mutazione potrebbe causare lo skipping dell’esone, l’attivazione di potenziali siti di splicing criptici oppure l’integrazione di parte dell’introne 4 nel mRNA. In ogni caso, il predetto mRNA aberrante introdurrebbe un frameshift e la formazione di un codone di stop prematuro con la conseguente sintesi di una proteina tronca oppure con la degradazione della proteina aberrante mediante nonsense-mediated mRNA decay. Per testare come

40

effettivamente questa mutazione alteri lo splicing sarebbe necessario effettuare l’analisi del cDNA, ma le cellule epiteliali respiratorie non erano disponibili.

Figura 15. Elettroferogramma delle mutazioni c.883-1G>A e c.4145G>A presenti nella famiglia A ed albero genealogico

Nei 6 pazienti con DCP e ultrastruttura ciliare alterata, sono state evidenziate alterazioni nel gene DNAH11 in 4 casi (tabella 7), mentre in 2 casi non sono state rilevate mutazioni. I pazienti presentano comunque una sola alterazione e sono mutazioni missenso (n=4) e piccole inserzioni (n=1).

41

N° paziente

Esone

Cambiamento

Cambiamento

Tipo di

nucleotidico

proteico

mutazione

11

83

c.13516G>A

p.E4507K

Missenso

13

27

c.4790G>T

p.C1597F

Missenso

15

53

c.8554C>G

p.R2852G

Missenso

16

83

c.13569_13570ins13

Inserzione

Tabella 7. Alterazioni nel gene DNAH11: esone, cambiamento nucleotidico e proteico, tipo di mutazione

Anche per queste alterazioni missenso è stata condotta sia l’analisi in silico con il programma PolyPhen che la valutazione dei residui aminoacidici evolutivamente conservati tra proteine appartenenti a differenti specie. Di seguito sono mostrati i risultati ottenuti. Posizione AA1 AA2 4507

E

K

Risultato This mutation is predicted to be benign with a score of 0.275 (sensitivity: 0.91; specificity: 0.89)

H. sapiens 4482 TYECPVYRTKLRGPSYIWTFRLKSEEKTAKWVLAGVALLLEA C. lupus 4469 TYECPVYKTKMRGSNYVWTFRLKSQDKTAKWVLAGVALLLEA B. taurus 4611 TYECPVYKTKRRGPHYVWTFRLKSKEKAAKWVLAGVALLLEA M. musculus 4447 AYECPVYKTKARGPTYVWTFRLRSKDRIAKWVLAGVALLLEA R. norvegicus 4531 AYECPVYKTKARGLTYVWTFRLRSKDRIAKWVLAGVALLLEA D. rerio 4437 TYECPVYKTKLRANTYIWTFSLKSRERPAKWVLAGVALLLSV

42

4523 4510 4652 4488 4572 4478

Posizione AA1 AA2 1597

C

F

Risultato This mutation is predicted to be possibly damaging with a score of 0.453 (sensitivity: 0.89; specificity: 0.90)

H. sapiens 1560 DIRIQLVKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQ C. lupus 1558 DIRIQLVKDARRFDGVDAEFKDLMLKTAKIKNVLDATCRPNLYEKLKDLQ B. taurus 1685 DIRIQLVKDAQRFDRVDAEFKELMFRTAKIKNVLEATCELHLYEKLKDLQ M. musculus 1536 DIRVQLVEDARRFDKVDAEFKELMFETAKVKNVLEATCRPHLYEKLKDFQ R. norvegicus 1614 DIRIQLVEDAQRFDEVDAEFKELMFKTAKIKNVLEATCRPHLYEKLKDFQ D. rerio 1520 DIRNQLAHVAERFQGIHQDFQGSMISIVETDNVIKVTNQPGFLEQLETLQ

Posizione AA1 AA2 2852

R

G

1609 1607 1734 1585 1663 1569

Risultato This mutation is predicted to be benign with a score of 0.001 (sensitivity: 0.99; specificity: 0.15)

H. sapiens 2833 HLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLE C. lupus 2820 HLVLFEDAMQHVCRISRILRTPQGHALLIGVGGSGKQSLSRLAAYICSLE B. taurus 2962 HLVLFEDAMQHVCRISRILQSPQGYALLIGVGGSGKQSLSRLAAYVCSLE M. musculus 2798 HLVLFEDAMQHVCRISRILRIPQGHALLIGVGGSGKQSLSRLAAYICSLE R. norvegicus 2882 HLVLFEDAMQHVCRISRILRTPQGHALLVGVGGSGKQSLSRLAAYICSLE D. rerio 2787 NLVLFEEAMQHICRISRILESPVGNALLIGVGGSGKQSLCRLAAFLSVLE

2882 2869 3011 2847 2931 2836

In questi casi, le tre mutazioni missenso identificate colpiscono residui non molto conservati tra le specie e l’analisi in silico prevede che siano benigne (score
View more...

Comments

Copyright © 2017 DOCUMEN Inc.